Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4803699..4804453 | Replicon | chromosome |
| Accession | NZ_CP117370 | ||
| Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain RM054 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP97_RS23590 | Protein ID | WP_000558166.1 |
| Coordinates | 4803699..4804010 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP97_RS23595 | Protein ID | WP_001259011.1 |
| Coordinates | 4804007..4804453 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP97_RS23560 (4799357) | 4799357..4800259 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQP97_RS23565 (4800256) | 4800256..4800891 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP97_RS23570 (4800888) | 4800888..4801817 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP97_RS23575 (4801864) | 4801864..4802154 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP97_RS23580 (4802155) | 4802155..4802466 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP97_RS23585 (4802684) | 4802684..4803613 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQP97_RS23590 (4803699) | 4803699..4804010 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP97_RS23595 (4804007) | 4804007..4804453 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP97_RS23600 (4804468) | 4804468..4805409 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP97_RS23605 (4805454) | 4805454..4805891 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQP97_RS23610 (4805888) | 4805888..4806760 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQP97_RS23615 (4806754) | 4806754..4807353 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP97_RS23620 (4807544) | 4807544..4808347 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP97_RS23625 (4808381) | 4808381..4809277 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270885 WP_000558166.1 NZ_CP117370:4803699-4804010 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270885 WP_001259011.1 NZ_CP117370:4804007-4804453 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|