Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2469519..2470041 | Replicon | chromosome |
| Accession | NZ_CP117370 | ||
| Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain RM054 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | PQP97_RS12185 | Protein ID | WP_000221343.1 |
| Coordinates | 2469757..2470041 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | PQP97_RS12180 | Protein ID | WP_000885424.1 |
| Coordinates | 2469519..2469767 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP97_RS12155 (2464735) | 2464735..2466201 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
| PQP97_RS12160 (2467009) | 2467009..2467723 | + | 715 | Protein_2379 | helix-turn-helix domain-containing protein | - |
| PQP97_RS12165 (2467779) | 2467779..2468687 | - | 909 | WP_010989018.1 | hypothetical protein | - |
| PQP97_RS12170 (2468830) | 2468830..2469162 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
| PQP97_RS12175 (2469152) | 2469152..2469367 | - | 216 | WP_000206207.1 | hypothetical protein | - |
| PQP97_RS12180 (2469519) | 2469519..2469767 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP97_RS12185 (2469757) | 2469757..2470041 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP97_RS12190 (2470212) | 2470212..2470601 | + | 390 | WP_000194089.1 | RidA family protein | - |
| PQP97_RS12195 (2470653) | 2470653..2471732 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| PQP97_RS12200 (2471925) | 2471925..2472413 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PQP97_RS12205 (2472458) | 2472458..2473966 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2464738..2476823 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270877 WP_000221343.1 NZ_CP117370:2469757-2470041 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |