Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13609..14266 Replicon plasmid pRM089_1
Accession NZ_CP117366
Organism Salmonella enterica subsp. enterica serovar Newport strain RM089

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag PQP78_RS23725 Protein ID WP_000270043.1
Coordinates 13916..14266 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQP78_RS23720 Protein ID WP_000124640.1
Coordinates 13609..13911 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP78_RS23675 (PQP78_23675) 9234..9662 + 429 WP_000591074.1 hypothetical protein -
PQP78_RS23680 (PQP78_23680) 9719..10078 + 360 WP_000422768.1 hypothetical protein -
PQP78_RS23685 (PQP78_23685) 10078..10524 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
PQP78_RS23690 (PQP78_23690) 10521..11039 + 519 WP_000210756.1 nitrite reductase -
PQP78_RS23695 (PQP78_23695) 11039..11269 + 231 WP_000972663.1 hypothetical protein -
PQP78_RS23700 (PQP78_23700) 11256..12113 + 858 WP_001167032.1 hypothetical protein -
PQP78_RS23705 (PQP78_23705) 12344..12871 + 528 WP_001236377.1 thermonuclease family protein -
PQP78_RS23710 (PQP78_23710) 12929..13201 + 273 WP_001043047.1 HU family DNA-binding protein -
PQP78_RS23715 (PQP78_23715) 13289..13582 + 294 WP_001239997.1 chromosome segregation protein ParM -
PQP78_RS23720 (PQP78_23720) 13609..13911 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
PQP78_RS23725 (PQP78_23725) 13916..14266 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP78_RS23730 (PQP78_23730) 14429..14977 + 549 WP_001061574.1 transcriptional regulator -
PQP78_RS23735 (PQP78_23735) 15318..15512 + 195 WP_000343597.1 hypothetical protein -
PQP78_RS23740 (PQP78_23740) 15523..15894 + 372 WP_000516916.1 hypothetical protein -
PQP78_RS23745 (PQP78_23745) 15887..16357 + 471 WP_001281821.1 hypothetical protein -
PQP78_RS23750 (PQP78_23750) 16372..16707 - 336 WP_000683476.1 hypothetical protein -
PQP78_RS23755 (PQP78_23755) 16804..17292 + 489 WP_001273096.1 DUF1643 domain-containing protein -
PQP78_RS23760 (PQP78_23760) 17295..17792 + 498 WP_000062185.1 hypothetical protein -
PQP78_RS23765 (PQP78_23765) 18007..18711 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
PQP78_RS23770 (PQP78_23770) 18776..18955 - 180 Protein_31 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2 - 1..146584 146584


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T270842 WP_000270043.1 NZ_CP117366:c14266-13916 [Salmonella enterica subsp. enterica serovar Newport]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT270842 WP_000124640.1 NZ_CP117366:c13911-13609 [Salmonella enterica subsp. enterica serovar Newport]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References