Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4666864..4667466 | Replicon | chromosome |
Accession | NZ_CP117357 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM096 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | PQQ15_RS22690 | Protein ID | WP_001159630.1 |
Coordinates | 4667155..4667466 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQQ15_RS22685 | Protein ID | WP_000362050.1 |
Coordinates | 4666864..4667154 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ15_RS22670 (4664357) | 4664357..4665259 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
PQQ15_RS22675 (4665256) | 4665256..4665891 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQQ15_RS22680 (4665888) | 4665888..4666817 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
PQQ15_RS22685 (4666864) | 4666864..4667154 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
PQQ15_RS22690 (4667155) | 4667155..4667466 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
PQQ15_RS22695 (4667684) | 4667684..4668613 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
PQQ15_RS22700 (4668699) | 4668699..4669010 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
PQQ15_RS22705 (4669007) | 4669007..4669453 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
PQQ15_RS22710 (4669468) | 4669468..4670409 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PQQ15_RS22715 (4670454) | 4670454..4670891 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
PQQ15_RS22720 (4670888) | 4670888..4671760 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
PQQ15_RS22725 (4671754) | 4671754..4672353 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T270779 WP_001159630.1 NZ_CP117357:c4667466-4667155 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270779 WP_000362050.1 NZ_CP117357:c4667154-4666864 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|