Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2467742..2468264 | Replicon | chromosome |
Accession | NZ_CP117357 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM096 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQQ15_RS12140 | Protein ID | WP_000221343.1 |
Coordinates | 2467980..2468264 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQQ15_RS12135 | Protein ID | WP_000885424.1 |
Coordinates | 2467742..2467990 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ15_RS12110 (2462960) | 2462960..2464424 | + | 1465 | Protein_2368 | hypothetical protein | - |
PQQ15_RS12115 (2465232) | 2465232..2465946 | + | 715 | Protein_2369 | helix-turn-helix domain-containing protein | - |
PQQ15_RS12120 (2466002) | 2466002..2466910 | - | 909 | WP_010989018.1 | hypothetical protein | - |
PQQ15_RS12125 (2467053) | 2467053..2467385 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PQQ15_RS12130 (2467375) | 2467375..2467590 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PQQ15_RS12135 (2467742) | 2467742..2467990 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQQ15_RS12140 (2467980) | 2467980..2468264 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ15_RS12145 (2468435) | 2468435..2468824 | + | 390 | WP_000194089.1 | RidA family protein | - |
PQQ15_RS12150 (2468876) | 2468876..2469955 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQQ15_RS12155 (2470147) | 2470147..2470635 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQQ15_RS12160 (2470680) | 2470680..2472188 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2462963..2475045 | 12082 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270772 WP_000221343.1 NZ_CP117357:2467980-2468264 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |