Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4652106..4652708 | Replicon | chromosome |
| Accession | NZ_CP117354 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM099 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | PQP84_RS22795 | Protein ID | WP_001159635.1 |
| Coordinates | 4652397..4652708 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP84_RS22790 | Protein ID | WP_000362050.1 |
| Coordinates | 4652106..4652396 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP84_RS22775 (4649599) | 4649599..4650501 | + | 903 | WP_000331367.1 | formate dehydrogenase subunit beta | - |
| PQP84_RS22780 (4650498) | 4650498..4651133 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP84_RS22785 (4651130) | 4651130..4652059 | + | 930 | WP_000027737.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP84_RS22790 (4652106) | 4652106..4652396 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PQP84_RS22795 (4652397) | 4652397..4652708 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| PQP84_RS22800 (4652926) | 4652926..4653855 | + | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
| PQP84_RS22805 (4653941) | 4653941..4654252 | + | 312 | WP_000558169.1 | type II toxin-antitoxin system HigB family toxin | - |
| PQP84_RS22810 (4654249) | 4654249..4654695 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PQP84_RS22815 (4654710) | 4654710..4655651 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP84_RS22820 (4655696) | 4655696..4656133 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP84_RS22825 (4656130) | 4656130..4657002 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP84_RS22830 (4656996) | 4656996..4657595 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T270756 WP_001159635.1 NZ_CP117354:c4652708-4652397 [Salmonella enterica subsp. enterica serovar Dublin]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270756 WP_000362050.1 NZ_CP117354:c4652396-4652106 [Salmonella enterica subsp. enterica serovar Dublin]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|