Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4647209..4647811 | Replicon | chromosome |
Accession | NZ_CP117351 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM100 |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | PQQ10_RS22790 | Protein ID | WP_001159635.1 |
Coordinates | 4647500..4647811 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQQ10_RS22785 | Protein ID | WP_000362050.1 |
Coordinates | 4647209..4647499 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ10_RS22770 (4644705) | 4644705..4645607 | + | 903 | WP_000331367.1 | formate dehydrogenase subunit beta | - |
PQQ10_RS22775 (4645604) | 4645604..4646236 | + | 633 | WP_274896031.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQQ10_RS22780 (4646233) | 4646233..4647162 | + | 930 | WP_000027737.1 | formate dehydrogenase accessory protein FdhE | - |
PQQ10_RS22785 (4647209) | 4647209..4647499 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
PQQ10_RS22790 (4647500) | 4647500..4647811 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
PQQ10_RS22795 (4648029) | 4648029..4648958 | + | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
PQQ10_RS22800 (4649044) | 4649044..4649355 | + | 312 | WP_000558169.1 | type II toxin-antitoxin system HigB family toxin | - |
PQQ10_RS22805 (4649352) | 4649352..4649798 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | - |
PQQ10_RS22810 (4649813) | 4649813..4650754 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PQQ10_RS22815 (4650799) | 4650799..4651236 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
PQQ10_RS22820 (4651233) | 4651233..4652105 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
PQQ10_RS22825 (4652099) | 4652099..4652698 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T270733 WP_001159635.1 NZ_CP117351:c4647811-4647500 [Salmonella enterica subsp. enterica serovar Dublin]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270733 WP_000362050.1 NZ_CP117351:c4647499-4647209 [Salmonella enterica subsp. enterica serovar Dublin]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|