Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 835197..835822 | Replicon | chromosome |
Accession | NZ_CP117351 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM100 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQQ10_RS04045 | Protein ID | WP_274896049.1 |
Coordinates | 835424..835822 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PQQ10_RS04040 | Protein ID | WP_000557549.1 |
Coordinates | 835197..835424 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ10_RS04010 (830205) | 830205..831722 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQQ10_RS04015 (831798) | 831798..832343 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQQ10_RS04020 (832608) | 832608..833366 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PQQ10_RS04030 (833651) | 833651..834457 | - | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
PQQ10_RS04035 (834737) | 834737..834988 | - | 252 | WP_001576352.1 | hypothetical protein | - |
PQQ10_RS04040 (835197) | 835197..835424 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQQ10_RS04045 (835424) | 835424..835822 | + | 399 | WP_274896049.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQQ10_RS04050 (836631) | 836631..837167 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
PQQ10_RS04055 (837214) | 837214..837846 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQQ10_RS04060 (838565) | 838565..839146 | + | 582 | WP_001244651.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 833651..845011 | 11360 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14986.34 Da Isoelectric Point: 7.2155
>T270720 WP_274896049.1 NZ_CP117351:835424-835822 [Salmonella enterica subsp. enterica serovar Dublin]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAFVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAFVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|