Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40235..40499 | Replicon | plasmid pRM101_2 |
| Accession | NZ_CP117350 | ||
| Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | PQQ11_RS24445 | Protein ID | WP_001303307.1 |
| Coordinates | 40347..40499 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 40235..40297 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ11_RS24430 (35474) | 35474..37765 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| PQQ11_RS24435 (37758) | 37758..38828 | - | 1071 | WP_274898323.1 | IncI1-type conjugal transfer protein TrbB | - |
| PQQ11_RS24440 (38847) | 38847..40055 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (40235) | 40235..40297 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (40235) | 40235..40297 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (40235) | 40235..40297 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (40235) | 40235..40297 | - | 63 | NuclAT_0 | - | Antitoxin |
| PQQ11_RS24445 (40347) | 40347..40499 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| PQQ11_RS24450 (40571) | 40571..40822 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| PQQ11_RS24455 (41321) | 41321..41416 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| PQQ11_RS24460 (41481) | 41481..41657 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| PQQ11_RS24465 (42049) | 42049..42258 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PQQ11_RS24470 (42330) | 42330..42980 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PQQ11_RS24475 (43054) | 43054..45222 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..86233 | 86233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T270712 WP_001303307.1 NZ_CP117350:40347-40499 [Salmonella enterica subsp. enterica serovar Heidelberg]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT270712 NZ_CP117350:c40297-40235 [Salmonella enterica subsp. enterica serovar Heidelberg]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|