Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40235..40499 Replicon plasmid pRM101_2
Accession NZ_CP117350
Organism Salmonella enterica subsp. enterica serovar Heidelberg strain RM101

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag PQQ11_RS24445 Protein ID WP_001303307.1
Coordinates 40347..40499 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40235..40297 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ11_RS24430 (35474) 35474..37765 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
PQQ11_RS24435 (37758) 37758..38828 - 1071 WP_274898323.1 IncI1-type conjugal transfer protein TrbB -
PQQ11_RS24440 (38847) 38847..40055 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (40235) 40235..40297 - 63 NuclAT_0 - Antitoxin
- (40235) 40235..40297 - 63 NuclAT_0 - Antitoxin
- (40235) 40235..40297 - 63 NuclAT_0 - Antitoxin
- (40235) 40235..40297 - 63 NuclAT_0 - Antitoxin
PQQ11_RS24445 (40347) 40347..40499 + 153 WP_001303307.1 Hok/Gef family protein Toxin
PQQ11_RS24450 (40571) 40571..40822 - 252 WP_001291964.1 hypothetical protein -
PQQ11_RS24455 (41321) 41321..41416 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
PQQ11_RS24460 (41481) 41481..41657 - 177 WP_001054904.1 hypothetical protein -
PQQ11_RS24465 (42049) 42049..42258 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
PQQ11_RS24470 (42330) 42330..42980 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
PQQ11_RS24475 (43054) 43054..45222 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..86233 86233


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T270712 WP_001303307.1 NZ_CP117350:40347-40499 [Salmonella enterica subsp. enterica serovar Heidelberg]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT270712 NZ_CP117350:c40297-40235 [Salmonella enterica subsp. enterica serovar Heidelberg]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References