Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13609..14266 Replicon plasmid pRM101_1
Accession NZ_CP117349
Organism Salmonella enterica subsp. enterica serovar Heidelberg strain RM101

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag PQQ11_RS23285 Protein ID WP_000270043.1
Coordinates 13916..14266 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQQ11_RS23280 Protein ID WP_000124640.1
Coordinates 13609..13911 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ11_RS23235 (PQQ11_23235) 9234..9662 + 429 WP_000591074.1 hypothetical protein -
PQQ11_RS23240 (PQQ11_23240) 9719..10078 + 360 WP_000422768.1 hypothetical protein -
PQQ11_RS23245 (PQQ11_23245) 10078..10524 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
PQQ11_RS23250 (PQQ11_23250) 10521..11039 + 519 WP_000210756.1 nitrite reductase -
PQQ11_RS23255 (PQQ11_23255) 11039..11269 + 231 WP_000972663.1 hypothetical protein -
PQQ11_RS23260 (PQQ11_23260) 11256..12113 + 858 WP_001167032.1 hypothetical protein -
PQQ11_RS23265 (PQQ11_23265) 12344..12871 + 528 WP_001236377.1 thermonuclease family protein -
PQQ11_RS23270 (PQQ11_23270) 12929..13201 + 273 WP_001043047.1 HU family DNA-binding protein -
PQQ11_RS23275 (PQQ11_23275) 13289..13582 + 294 WP_001239997.1 chromosome segregation protein ParM -
PQQ11_RS23280 (PQQ11_23280) 13609..13911 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
PQQ11_RS23285 (PQQ11_23285) 13916..14266 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ11_RS23290 (PQQ11_23290) 14429..14977 + 549 WP_001061574.1 transcriptional regulator -
PQQ11_RS23300 (PQQ11_23300) 16632..16826 + 195 WP_000343597.1 hypothetical protein -
PQQ11_RS23305 (PQQ11_23305) 16837..17208 + 372 WP_000516916.1 hypothetical protein -
PQQ11_RS23310 (PQQ11_23310) 17201..17671 + 471 WP_001281821.1 hypothetical protein -
PQQ11_RS23315 (PQQ11_23315) 17686..18021 - 336 WP_000683476.1 hypothetical protein -
PQQ11_RS23320 (PQQ11_23320) 18118..18606 + 489 WP_001273096.1 DUF1643 domain-containing protein -
PQQ11_RS23325 (PQQ11_23325) 18609..19106 + 498 WP_000062185.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2 / ant(3'')-Ia / qacE / sul1 / dfrA34 / aph(3')-Ia / tet(O) / tet(B) - 1..180389 180389


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T270711 WP_000270043.1 NZ_CP117349:c14266-13916 [Salmonella enterica subsp. enterica serovar Heidelberg]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT270711 WP_000124640.1 NZ_CP117349:c13911-13609 [Salmonella enterica subsp. enterica serovar Heidelberg]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References