Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4589846..4590600 | Replicon | chromosome |
| Accession | NZ_CP117348 | ||
| Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | PQQ11_RS22260 | Protein ID | WP_000558163.1 |
| Coordinates | 4589846..4590157 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ11_RS22265 | Protein ID | WP_001259012.1 |
| Coordinates | 4590154..4590600 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ11_RS22230 (4585504) | 4585504..4586406 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ11_RS22235 (4586403) | 4586403..4587038 | + | 636 | WP_274896181.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ11_RS22240 (4587035) | 4587035..4587964 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ11_RS22245 (4588011) | 4588011..4588301 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ11_RS22250 (4588302) | 4588302..4588613 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQQ11_RS22255 (4588831) | 4588831..4589760 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| PQQ11_RS22260 (4589846) | 4589846..4590157 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ11_RS22265 (4590154) | 4590154..4590600 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ11_RS22270 (4590615) | 4590615..4591556 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ11_RS22275 (4591601) | 4591601..4592038 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ11_RS22280 (4592035) | 4592035..4592907 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQQ11_RS22285 (4592901) | 4592901..4593500 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| PQQ11_RS22290 (4593691) | 4593691..4594494 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ11_RS22295 (4594528) | 4594528..4595424 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T270710 WP_000558163.1 NZ_CP117348:4589846-4590157 [Salmonella enterica subsp. enterica serovar Heidelberg]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT270710 WP_001259012.1 NZ_CP117348:4590154-4590600 [Salmonella enterica subsp. enterica serovar Heidelberg]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|