Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 383336..383874 | Replicon | chromosome |
Accession | NZ_CP117348 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A8E7RBX8 |
Locus tag | PQQ11_RS01780 | Protein ID | WP_001682450.1 |
Coordinates | 383599..383874 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A7U1KUN1 |
Locus tag | PQQ11_RS01775 | Protein ID | WP_000729714.1 |
Coordinates | 383336..383596 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ11_RS01760 (379047) | 379047..380600 | + | 1554 | WP_000013007.1 | TROVE domain-containing protein | - |
PQQ11_RS01765 (380948) | 380948..382162 | + | 1215 | WP_001105530.1 | RNA-splicing ligase RtcB | - |
PQQ11_RS01770 (382166) | 382166..383227 | + | 1062 | WP_000101032.1 | RNA 3'-terminal phosphate cyclase | - |
PQQ11_RS01775 (383336) | 383336..383596 | + | 261 | WP_000729714.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQQ11_RS01780 (383599) | 383599..383874 | + | 276 | WP_001682450.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQQ11_RS01785 (383962) | 383962..386667 | - | 2706 | WP_000907043.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10605.16 Da Isoelectric Point: 8.9063
>T270696 WP_001682450.1 NZ_CP117348:383599-383874 [Salmonella enterica subsp. enterica serovar Heidelberg]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILVDKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILVDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|