Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 134245..134902 | Replicon | plasmid pRM104_1 |
| Accession | NZ_CP117347 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM104 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | PQP85_RS24620 | Protein ID | WP_000270043.1 |
| Coordinates | 134245..134595 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP85_RS24625 | Protein ID | WP_000124640.1 |
| Coordinates | 134600..134902 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP85_RS24580 (PQP85_24580) | 130169..130348 | + | 180 | Protein_165 | helix-turn-helix domain-containing protein | - |
| PQP85_RS24585 (PQP85_24585) | 130413..131117 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PQP85_RS24590 (PQP85_24590) | 131219..131707 | - | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| PQP85_RS24595 (PQP85_24595) | 131804..132139 | + | 336 | WP_000683476.1 | hypothetical protein | - |
| PQP85_RS24600 (PQP85_24600) | 132154..132624 | - | 471 | WP_001281821.1 | hypothetical protein | - |
| PQP85_RS24605 (PQP85_24605) | 132617..132988 | - | 372 | WP_000516916.1 | hypothetical protein | - |
| PQP85_RS24610 (PQP85_24610) | 132999..133193 | - | 195 | WP_000343597.1 | hypothetical protein | - |
| PQP85_RS24615 (PQP85_24615) | 133534..134082 | - | 549 | WP_001061574.1 | transcriptional regulator | - |
| PQP85_RS24620 (PQP85_24620) | 134245..134595 | + | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP85_RS24625 (PQP85_24625) | 134600..134902 | + | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| PQP85_RS24630 (PQP85_24630) | 134929..135222 | - | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
| PQP85_RS24635 (PQP85_24635) | 135310..135582 | - | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
| PQP85_RS24640 (PQP85_24640) | 135640..136167 | - | 528 | WP_001236377.1 | thermonuclease family protein | - |
| PQP85_RS24645 (PQP85_24645) | 136398..137255 | - | 858 | WP_001167032.1 | hypothetical protein | - |
| PQP85_RS24650 (PQP85_24650) | 137242..137472 | - | 231 | WP_000972663.1 | hypothetical protein | - |
| PQP85_RS24655 (PQP85_24655) | 137472..137990 | - | 519 | WP_000210756.1 | nitrite reductase | - |
| PQP85_RS24660 (PQP85_24660) | 137987..138433 | - | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
| PQP85_RS24665 (PQP85_24665) | 138433..138792 | - | 360 | WP_000422768.1 | hypothetical protein | - |
| PQP85_RS24670 (PQP85_24670) | 138849..139277 | - | 429 | WP_000591074.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aph(3')-Ia / blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | faeH / faeI / fdeC / spvC / spvB | 1..178387 | 178387 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T270694 WP_000270043.1 NZ_CP117347:134245-134595 [Salmonella enterica subsp. enterica serovar Dublin]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT270694 WP_000124640.1 NZ_CP117347:134600-134902 [Salmonella enterica subsp. enterica serovar Dublin]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|