Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4657394..4658148 | Replicon | chromosome |
| Accession | NZ_CP117346 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM104 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Z3FVU6 |
| Locus tag | PQP85_RS22825 | Protein ID | WP_000558169.1 |
| Coordinates | 4657394..4657705 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP85_RS22830 | Protein ID | WP_001259012.1 |
| Coordinates | 4657702..4658148 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP85_RS22795 (4653052) | 4653052..4653954 | + | 903 | WP_000331367.1 | formate dehydrogenase subunit beta | - |
| PQP85_RS22800 (4653951) | 4653951..4654586 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP85_RS22805 (4654583) | 4654583..4655512 | + | 930 | WP_000027737.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP85_RS22810 (4655559) | 4655559..4655849 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP85_RS22815 (4655850) | 4655850..4656161 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP85_RS22820 (4656379) | 4656379..4657308 | + | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
| PQP85_RS22825 (4657394) | 4657394..4657705 | + | 312 | WP_000558169.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP85_RS22830 (4657702) | 4657702..4658148 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP85_RS22835 (4658163) | 4658163..4659104 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP85_RS22840 (4659149) | 4659149..4659586 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP85_RS22845 (4659583) | 4659583..4660455 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP85_RS22850 (4660449) | 4660449..4661048 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP85_RS22855 (4661239) | 4661239..4662042 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP85_RS22860 (4662076) | 4662076..4662972 | - | 897 | WP_001575213.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12450.37 Da Isoelectric Point: 9.2536
>T270690 WP_000558169.1 NZ_CP117346:4657394-4657705 [Salmonella enterica subsp. enterica serovar Dublin]
VHVISRKPFNEAMLMYPNHELDLTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELDLTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT270690 WP_001259012.1 NZ_CP117346:4657702-4658148 [Salmonella enterica subsp. enterica serovar Dublin]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|