Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 358003..358541 | Replicon | chromosome |
Accession | NZ_CP117346 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM104 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | PQP85_RS01625 | Protein ID | WP_001526148.1 |
Coordinates | 358266..358541 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | M7RMV7 |
Locus tag | PQP85_RS01620 | Protein ID | WP_000729713.1 |
Coordinates | 358003..358263 (+) | Length | 87 a.a. |
Genomic Context
Location: 353764..355317 (1554 bp)
Type: Others
Protein ID: WP_000013013.1
Type: Others
Protein ID: WP_000013013.1
Location: 355665..356879 (1215 bp)
Type: Others
Protein ID: WP_052895987.1
Type: Others
Protein ID: WP_052895987.1
Location: 356883..357894 (1012 bp)
Type: Others
Protein ID: Protein_318
Type: Others
Protein ID: Protein_318
Location: 358003..358263 (261 bp)
Type: Antitoxin
Protein ID: WP_000729713.1
Type: Antitoxin
Protein ID: WP_000729713.1
Location: 358266..358541 (276 bp)
Type: Toxin
Protein ID: WP_001526148.1
Type: Toxin
Protein ID: WP_001526148.1
Location: 358629..361334 (2706 bp)
Type: Others
Protein ID: WP_000907030.1
Type: Others
Protein ID: WP_000907030.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP85_RS01605 (353764) | 353764..355317 | + | 1554 | WP_000013013.1 | TROVE domain-containing protein | - |
PQP85_RS01610 (355665) | 355665..356879 | + | 1215 | WP_052895987.1 | RNA-splicing ligase RtcB | - |
PQP85_RS01615 (356883) | 356883..357894 | + | 1012 | Protein_318 | RNA 3'-terminal phosphate cyclase | - |
PQP85_RS01620 (358003) | 358003..358263 | + | 261 | WP_000729713.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP85_RS01625 (358266) | 358266..358541 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQP85_RS01630 (358629) | 358629..361334 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T270674 WP_001526148.1 NZ_CP117346:358266-358541 [Salmonella enterica subsp. enterica serovar Dublin]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D6P2L2 |