Detailed information of TA system TA270645

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/COG4683-HTH_37
• Location: 13511..14168
• Replicon: plasmid pRM111_1
• Accession: NZ_CP117341
• Organism: Salmonella enterica subsp. enterica serovar Dublin strain RM111

Toxin (Protein)

• Gene name: higB
• Uniprot ID: U3PDC3
• Locus tag: PQQ02_RS23815
• Protein ID: WP_000270043.1
• Coordinates: 13818..14168 (-)
• Length: 117 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: PQQ02_RS23810
• Protein ID: WP_000124640.1
• Coordinates: 13511..13813 (-)
• Length: 101 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PQQ02_RS23765 (PQQ02_23765)	9136..9564	+	429	WP_000591074.1	hypothetical protein	-
PQQ02_RS23770 (PQQ02_23770)	9621..9980	+	360	WP_000422768.1	hypothetical protein	-
PQQ02_RS23775 (PQQ02_23775)	9980..10426	+	447	WP_000919345.1	Fe3+-siderophore ABC transporter permease	-
PQQ02_RS23780 (PQQ02_23780)	10423..10941	+	519	WP_000210756.1	nitrite reductase	-
PQQ02_RS23785 (PQQ02_23785)	10941..11171	+	231	WP_000972663.1	hypothetical protein	-
PQQ02_RS23790 (PQQ02_23790)	11158..12015	+	858	WP_001167032.1	hypothetical protein	-
PQQ02_RS23795 (PQQ02_23795)	12246..12773	+	528	WP_001236377.1	thermonuclease family protein	-
PQQ02_RS23800 (PQQ02_23800)	12831..13103	+	273	WP_001043047.1	HU family DNA-binding protein	-
PQQ02_RS23805 (PQQ02_23805)	13191..13484	+	294	WP_001239997.1	chromosome segregation protein ParM	-
PQQ02_RS23810 (PQQ02_23810)	13511..13813	-	303	WP_000124640.1	XRE family transcriptional regulator	Antitoxin
PQQ02_RS23815 (PQQ02_23815)	13818..14168	-	351	WP_000270043.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
PQQ02_RS23820 (PQQ02_23820)	14331..14879	+	549	WP_001061574.1	transcriptional regulator	-
PQQ02_RS23825 (PQQ02_23825)	15220..15414	+	195	WP_000343597.1	hypothetical protein	-
PQQ02_RS23830 (PQQ02_23830)	15425..15796	+	372	WP_000516916.1	hypothetical protein	-
PQQ02_RS23835 (PQQ02_23835)	15789..16259	+	471	WP_001281821.1	hypothetical protein	-
PQQ02_RS23840 (PQQ02_23840)	16274..16609	-	336	WP_000683476.1	hypothetical protein	-
PQQ02_RS23845 (PQQ02_23845)	16706..17194	+	489	WP_001273096.1	DUF1643 domain-containing protein	-
PQQ02_RS23850 (PQQ02_23850)	17197..17694	+	498	WP_000062185.1	hypothetical protein	-
PQQ02_RS23855 (PQQ02_23855)	17909..18613	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
PQQ02_RS23860 (PQQ02_23860)	18920..19003	+	84	Protein_30	transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCMY-2	-	1..86676	86676

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin HigB-like (12-106)

Antitoxin

• Cro/C1-type helix-turn-helix domain (33-79)

Sequences

Toxin

Protein

• Length: 117 a.a.
• Molecular weight: 13328.21 Da
• Isoelectric Point: 5.2421

>T270645 WP_000270043.1 NZ_CP117341:c14168-13818 [Salmonella enterica subsp. enterica serovar Dublin]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Nucleotide

• Length: 351 bp

Antitoxin

Protein

• Length: 101 a.a.
• Molecular weight: 11006.73 Da
• Isoelectric Point: 7.2036

>AT270645 WP_000124640.1 NZ_CP117341:c13813-13511 [Salmonella enterica subsp. enterica serovar Dublin]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Nucleotide

• Length: 303 bp

Structures

Toxin

• AlphaFold DB: A0A7G8AFB9