Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 835022..835647 | Replicon | chromosome |
Accession | NZ_CP117340 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM111 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | PQQ02_RS04040 | Protein ID | WP_000911336.1 |
Coordinates | 835249..835647 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PQQ02_RS04035 | Protein ID | WP_000557549.1 |
Coordinates | 835022..835249 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ02_RS04005 (830030) | 830030..831547 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQQ02_RS04010 (831623) | 831623..832168 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQQ02_RS04015 (832433) | 832433..833191 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PQQ02_RS04025 (833476) | 833476..834282 | - | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
PQQ02_RS04030 (834562) | 834562..834813 | - | 252 | WP_001576352.1 | hypothetical protein | - |
PQQ02_RS04035 (835022) | 835022..835249 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQQ02_RS04040 (835249) | 835249..835647 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQQ02_RS04045 (836455) | 836455..836991 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
PQQ02_RS04050 (837038) | 837038..837670 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQQ02_RS04055 (838389) | 838389..838970 | + | 582 | WP_001244651.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 833476..844837 | 11361 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T270630 WP_000911336.1 NZ_CP117340:835249-835647 [Salmonella enterica subsp. enterica serovar Dublin]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |