Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4671301..4672055 | Replicon | chromosome |
| Accession | NZ_CP117338 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM095 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP94_RS22830 | Protein ID | WP_000558166.1 |
| Coordinates | 4671301..4671612 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP94_RS22835 | Protein ID | WP_001259011.1 |
| Coordinates | 4671609..4672055 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP94_RS22800 (4666959) | 4666959..4667861 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQP94_RS22805 (4667858) | 4667858..4668493 | + | 636 | WP_274895786.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP94_RS22810 (4668490) | 4668490..4669419 | + | 930 | WP_058685073.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP94_RS22815 (4669466) | 4669466..4669756 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP94_RS22820 (4669757) | 4669757..4670068 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP94_RS22825 (4670286) | 4670286..4671215 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQP94_RS22830 (4671301) | 4671301..4671612 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP94_RS22835 (4671609) | 4671609..4672055 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP94_RS22840 (4672070) | 4672070..4673011 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP94_RS22845 (4673056) | 4673056..4673493 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQP94_RS22850 (4673490) | 4673490..4674362 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQP94_RS22855 (4674356) | 4674356..4674955 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP94_RS22860 (4675146) | 4675146..4675949 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP94_RS22865 (4675983) | 4675983..4676879 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270624 WP_000558166.1 NZ_CP117338:4671301-4671612 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270624 WP_001259011.1 NZ_CP117338:4671609-4672055 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|