Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4654499..4655253 | Replicon | chromosome |
| Accession | NZ_CP117336 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM052 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Z3FVU6 |
| Locus tag | PQP91_RS22800 | Protein ID | WP_000558169.1 |
| Coordinates | 4654499..4654810 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP91_RS22805 | Protein ID | WP_001259012.1 |
| Coordinates | 4654807..4655253 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP91_RS22770 (4650157) | 4650157..4651059 | + | 903 | WP_000331367.1 | formate dehydrogenase subunit beta | - |
| PQP91_RS22775 (4651056) | 4651056..4651691 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP91_RS22780 (4651688) | 4651688..4652617 | + | 930 | WP_000027737.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP91_RS22785 (4652664) | 4652664..4652954 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP91_RS22790 (4652955) | 4652955..4653266 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP91_RS22795 (4653484) | 4653484..4654413 | + | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
| PQP91_RS22800 (4654499) | 4654499..4654810 | + | 312 | WP_000558169.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP91_RS22805 (4654807) | 4654807..4655253 | + | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP91_RS22810 (4655268) | 4655268..4656209 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP91_RS22815 (4656254) | 4656254..4656691 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP91_RS22820 (4656688) | 4656688..4657560 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP91_RS22825 (4657554) | 4657554..4658153 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP91_RS22830 (4658344) | 4658344..4659147 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP91_RS22835 (4659181) | 4659181..4660077 | - | 897 | WP_001575213.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12450.37 Da Isoelectric Point: 9.2536
>T270601 WP_000558169.1 NZ_CP117336:4654499-4654810 [Salmonella enterica subsp. enterica serovar Dublin]
VHVISRKPFNEAMLMYPNHELDLTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELDLTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16750.08 Da Isoelectric Point: 6.6451
>AT270601 WP_001259012.1 NZ_CP117336:4654807-4655253 [Salmonella enterica subsp. enterica serovar Dublin]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|