Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 65356..65609 | Replicon | plasmid pRM055_1 |
Accession | NZ_CP117333 | ||
Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | PQP79_RS23210 | Protein ID | WP_064764570.1 |
Coordinates | 65460..65609 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 65356..65410 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP79_RS23180 (60504) | 60504..61064 | + | 561 | WP_021569950.1 | fertility inhibition protein FinO | - |
PQP79_RS23185 (61845) | 61845..63434 | + | 1590 | WP_244578662.1 | YadA C-terminal domain-containing protein | - |
PQP79_RS23190 (63436) | 63436..63897 | + | 462 | WP_021553165.1 | thermonuclease family protein | - |
PQP79_RS23195 (63943) | 63943..64152 | + | 210 | WP_001333231.1 | hemolysin expression modulator Hha | - |
PQP79_RS23200 (64190) | 64190..64876 | + | 687 | WP_097178542.1 | DUF2726 domain-containing protein | - |
PQP79_RS23205 (64873) | 64873..65181 | + | 309 | WP_096936303.1 | hypothetical protein | - |
- (65356) | 65356..65410 | - | 55 | NuclAT_1 | - | Antitoxin |
- (65356) | 65356..65410 | - | 55 | NuclAT_1 | - | Antitoxin |
- (65356) | 65356..65410 | - | 55 | NuclAT_1 | - | Antitoxin |
- (65356) | 65356..65410 | - | 55 | NuclAT_1 | - | Antitoxin |
PQP79_RS23210 (65460) | 65460..65609 | + | 150 | WP_064764570.1 | Hok/Gef family protein | Toxin |
PQP79_RS23215 (65893) | 65893..66147 | + | 255 | WP_000083830.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..66452 | 66452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T270580 WP_064764570.1 NZ_CP117333:65460-65609 [Salmonella enterica subsp. enterica serovar Muenster]
MTKYALIGLIAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLIAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T270580 NZ_CP117333:65460-65609 [Salmonella enterica subsp. enterica serovar Muenster]
ATGACGAAATATGCCCTTATCGGGTTGATCGCTGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGATCGCTGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 55 bp
>AT270580 NZ_CP117333:c65410-65356 [Salmonella enterica subsp. enterica serovar Muenster]
ACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
ACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|