Detailed information of TA system TA270577

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 20653..21079
• Replicon: plasmid pRM055_1
• Accession: NZ_CP117333
• Organism: Salmonella enterica subsp. enterica serovar Muenster strain RM055

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PQP79_RS22930
• Protein ID: WP_001372321.1
• Coordinates: 20954..21079 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	20653..20877 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PQP79_RS22885 (15703)	15703..15939	+	237	Protein_23	hypothetical protein	-
PQP79_RS22890 (15828)	15828..16109	+	282	WP_072277694.1	hypothetical protein	-
PQP79_RS22895 (16350)	16350..16556	+	207	WP_000547968.1	hypothetical protein	-
PQP79_RS22900 (16582)	16582..17103	+	522	WP_021553184.1	single-stranded DNA-binding protein	-
PQP79_RS22905 (17161)	17161..17394	+	234	WP_021553185.1	DUF905 domain-containing protein	-
PQP79_RS22910 (17458)	17458..19422	+	1965	WP_274881742.1	ParB/RepB/Spo0J family partition protein	-
PQP79_RS22915 (19491)	19491..19925	+	435	WP_274881743.1	conjugation system SOS inhibitor PsiB	-
PQP79_RS22920 (19922)	19922..20684	+	763	Protein_30	plasmid SOS inhibition protein A	-
- (20653)	20653..20877	+	225	NuclAT_0	-	Antitoxin
- (20653)	20653..20877	+	225	NuclAT_0	-	Antitoxin
- (20653)	20653..20877	+	225	NuclAT_0	-	Antitoxin
- (20653)	20653..20877	+	225	NuclAT_0	-	Antitoxin
PQP79_RS22925 (20863)	20863..21012	+	150	Protein_31	plasmid maintenance protein Mok	-
PQP79_RS22930 (20954)	20954..21079	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PQP79_RS22935 (21314)	21314..21673	-	360	WP_024223173.1	hypothetical protein	-
PQP79_RS22940 (21743)	21743..22015	+	273	WP_223724002.1	single-stranded DNA-binding protein	-
PQP79_RS22945 (21969)	21969..22292	+	324	WP_000533253.1	hypothetical protein	-
PQP79_RS22950 (22351)	22351..22593	+	243	WP_000540591.1	hypothetical protein	-
PQP79_RS22955 (22793)	22793..23216	-	424	Protein_37	hypothetical protein	-
PQP79_RS22960 (23286)	23286..23492	+	207	WP_000547974.1	hypothetical protein	-
PQP79_RS22965 (23516)	23516..23812	+	297	WP_021553188.1	hypothetical protein	-
PQP79_RS22970 (23923)	23923..24744	+	822	WP_021553189.1	DUF932 domain-containing protein	-
PQP79_RS22975 (25040)	25040..25549	-	510	WP_021553190.1	transglycosylase SLT domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..66452	66452

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T270577 WP_001372321.1 NZ_CP117333:20954-21079 [Salmonella enterica subsp. enterica serovar Muenster]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT270577 NZ_CP117333:20653-20877 [Salmonella enterica subsp. enterica serovar Muenster]
TCACACGGATTTCCCGTGAACGGACTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCATGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin