Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4507043..4507797 | Replicon | chromosome |
| Accession | NZ_CP117332 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM055 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP79_RS21845 | Protein ID | WP_000558166.1 |
| Coordinates | 4507043..4507354 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP79_RS21850 | Protein ID | WP_001259011.1 |
| Coordinates | 4507351..4507797 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP79_RS21815 (4502701) | 4502701..4503603 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQP79_RS21820 (4503600) | 4503600..4504235 | + | 636 | WP_274881231.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP79_RS21825 (4504232) | 4504232..4505161 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP79_RS21830 (4505208) | 4505208..4505498 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP79_RS21835 (4505499) | 4505499..4505810 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP79_RS21840 (4506028) | 4506028..4506957 | + | 930 | WP_001609281.1 | alpha/beta hydrolase | - |
| PQP79_RS21845 (4507043) | 4507043..4507354 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP79_RS21850 (4507351) | 4507351..4507797 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP79_RS21855 (4507812) | 4507812..4508753 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP79_RS21860 (4508798) | 4508798..4509235 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP79_RS21865 (4509232) | 4509232..4510104 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP79_RS21870 (4510098) | 4510098..4510697 | - | 600 | WP_001646959.1 | glucose-1-phosphatase | - |
| PQP79_RS21875 (4510888) | 4510888..4511691 | - | 804 | WP_023137059.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP79_RS21880 (4511725) | 4511725..4512621 | - | 897 | WP_023137058.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270576 WP_000558166.1 NZ_CP117332:4507043-4507354 [Salmonella enterica subsp. enterica serovar Muenster]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270576 WP_001259011.1 NZ_CP117332:4507351-4507797 [Salmonella enterica subsp. enterica serovar Muenster]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|