Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4557269..4558023 | Replicon | chromosome |
| Accession | NZ_CP117329 | ||
| Organism | Salmonella enterica subsp. enterica serovar Muenster strain RM074 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP80_RS22250 | Protein ID | WP_000558166.1 |
| Coordinates | 4557269..4557580 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP80_RS22255 | Protein ID | WP_001259011.1 |
| Coordinates | 4557577..4558023 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP80_RS22220 (4552927) | 4552927..4553829 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQP80_RS22225 (4553826) | 4553826..4554461 | + | 636 | WP_274880155.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP80_RS22230 (4554458) | 4554458..4555387 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP80_RS22235 (4555434) | 4555434..4555724 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP80_RS22240 (4555725) | 4555725..4556036 | - | 312 | WP_001159632.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP80_RS22245 (4556254) | 4556254..4557183 | + | 930 | WP_001609281.1 | alpha/beta hydrolase | - |
| PQP80_RS22250 (4557269) | 4557269..4557580 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP80_RS22255 (4557577) | 4557577..4558023 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP80_RS22260 (4558038) | 4558038..4558979 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP80_RS22265 (4559024) | 4559024..4559461 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP80_RS22270 (4559458) | 4559458..4560330 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP80_RS22275 (4560324) | 4560324..4560923 | - | 600 | WP_001646959.1 | glucose-1-phosphatase | - |
| PQP80_RS22280 (4561114) | 4561114..4561917 | - | 804 | WP_023137059.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP80_RS22285 (4561951) | 4561951..4562847 | - | 897 | WP_023137058.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270559 WP_000558166.1 NZ_CP117329:4557269-4557580 [Salmonella enterica subsp. enterica serovar Muenster]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270559 WP_001259011.1 NZ_CP117329:4557577-4558023 [Salmonella enterica subsp. enterica serovar Muenster]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|