Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4539206..4539960 | Replicon | chromosome |
| Accession | NZ_CP117327 | ||
| Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP95_RS21805 | Protein ID | WP_000558166.1 |
| Coordinates | 4539206..4539517 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP95_RS21810 | Protein ID | WP_001259011.1 |
| Coordinates | 4539514..4539960 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP95_RS21775 (4534864) | 4534864..4535766 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQP95_RS21780 (4535763) | 4535763..4536398 | + | 636 | WP_274891226.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP95_RS21785 (4536395) | 4536395..4537324 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP95_RS21790 (4537371) | 4537371..4537661 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP95_RS21795 (4537662) | 4537662..4537973 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQP95_RS21800 (4538191) | 4538191..4539120 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQP95_RS21805 (4539206) | 4539206..4539517 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP95_RS21810 (4539514) | 4539514..4539960 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP95_RS21815 (4539975) | 4539975..4540916 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP95_RS21820 (4540961) | 4540961..4541398 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQP95_RS21825 (4541395) | 4541395..4542267 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQP95_RS21830 (4542261) | 4542261..4542860 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP95_RS21835 (4543051) | 4543051..4543854 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP95_RS21840 (4543888) | 4543888..4544784 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270539 WP_000558166.1 NZ_CP117327:4539206-4539517 [Salmonella enterica subsp. enterica serovar Saintpaul]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270539 WP_001259011.1 NZ_CP117327:4539514-4539960 [Salmonella enterica subsp. enterica serovar Saintpaul]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|