Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2329375..2329897 | Replicon | chromosome |
Accession | NZ_CP117327 | ||
Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQP95_RS11205 | Protein ID | WP_000221343.1 |
Coordinates | 2329613..2329897 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP95_RS11200 | Protein ID | WP_000885424.1 |
Coordinates | 2329375..2329623 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP95_RS11180 (2325271) | 2325271..2326737 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
PQP95_RS11185 (2327545) | 2327545..2328259 | + | 715 | Protein_2184 | helix-turn-helix domain-containing protein | - |
PQP95_RS11190 (2328315) | 2328315..2328974 | - | 660 | Protein_2185 | hypothetical protein | - |
PQP95_RS11195 (2329008) | 2329008..2329223 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PQP95_RS11200 (2329375) | 2329375..2329623 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP95_RS11205 (2329613) | 2329613..2329897 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP95_RS11210 (2330068) | 2330068..2330457 | + | 390 | WP_000194089.1 | RidA family protein | - |
PQP95_RS11215 (2330509) | 2330509..2331588 | - | 1080 | WP_000954691.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP95_RS11220 (2331781) | 2331781..2332269 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP95_RS11225 (2332314) | 2332314..2333822 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2325274..2336679 | 11405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270531 WP_000221343.1 NZ_CP117327:2329613-2329897 [Salmonella enterica subsp. enterica serovar Saintpaul]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |