Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 364530..365068 | Replicon | chromosome |
Accession | NZ_CP117327 | ||
Organism | Salmonella enterica subsp. enterica serovar Saintpaul strain RM106 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A7U1Q7V6 |
Locus tag | PQP95_RS01665 | Protein ID | WP_001521736.1 |
Coordinates | 364793..365068 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A5V2G724 |
Locus tag | PQP95_RS01660 | Protein ID | WP_000729830.1 |
Coordinates | 364530..364790 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP95_RS01645 (360285) | 360285..361838 | + | 1554 | WP_000013017.1 | TROVE domain-containing protein | - |
PQP95_RS01650 (362184) | 362184..363398 | + | 1215 | WP_023137705.1 | RNA-splicing ligase RtcB | - |
PQP95_RS01655 (363402) | 363402..364421 | + | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
PQP95_RS01660 (364530) | 364530..364790 | + | 261 | WP_000729830.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP95_RS01665 (364793) | 364793..365068 | + | 276 | WP_001521736.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQP95_RS01670 (365156) | 365156..367861 | - | 2706 | WP_274891280.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10618.25 Da Isoelectric Point: 9.7714
>T270523 WP_001521736.1 NZ_CP117327:364793-365068 [Salmonella enterica subsp. enterica serovar Saintpaul]
MGQRKIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
MGQRKIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1Q7V6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5V2G724 |