Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4650827..4651429 | Replicon | chromosome |
Accession | NZ_CP117322 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM001 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3Y7R225 |
Locus tag | PQP82_RS22615 | Protein ID | WP_023232499.1 |
Coordinates | 4651118..4651429 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQP82_RS22610 | Protein ID | WP_000362050.1 |
Coordinates | 4650827..4651117 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP82_RS22595 (4648320) | 4648320..4649222 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
PQP82_RS22600 (4649219) | 4649219..4649854 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQP82_RS22605 (4649851) | 4649851..4650780 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
PQP82_RS22610 (4650827) | 4650827..4651117 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
PQP82_RS22615 (4651118) | 4651118..4651429 | - | 312 | WP_023232499.1 | hypothetical protein | Toxin |
PQP82_RS22620 (4651647) | 4651647..4652576 | + | 930 | WP_023232500.1 | alpha/beta hydrolase | - |
PQP82_RS22625 (4652662) | 4652662..4652973 | + | 312 | WP_000558164.1 | type II toxin-antitoxin system HigB family toxin | - |
PQP82_RS22630 (4652970) | 4652970..4653416 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
PQP82_RS22635 (4653431) | 4653431..4654372 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PQP82_RS22640 (4654417) | 4654417..4654854 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
PQP82_RS22645 (4654851) | 4654851..4655720 | - | 870 | WP_023203606.1 | virulence factor BrkB family protein | - |
PQP82_RS22650 (4655714) | 4655714..4656313 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12388.34 Da Isoelectric Point: 9.4460
>T270504 WP_023232499.1 NZ_CP117322:c4651429-4651118 [Salmonella enterica subsp. enterica serovar Derby]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGVRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGVRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270504 WP_000362050.1 NZ_CP117322:c4651117-4650827 [Salmonella enterica subsp. enterica serovar Derby]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|