Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41461..41725 Replicon plasmid pRM002_1
Accession NZ_CP117318
Organism Salmonella enterica subsp. enterica serovar Derby strain RM002

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PQQ14_RS23720 Protein ID WP_001331364.1
Coordinates 41573..41725 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 41461..41518 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ14_RS23705 (36700) 36700..38991 - 2292 WP_274881823.1 F-type conjugative transfer protein TrbC -
PQQ14_RS23710 (38984) 38984..40054 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
PQQ14_RS23715 (40073) 40073..41281 - 1209 WP_039005623.1 IncI1-type conjugal transfer protein TrbA -
- (41461) 41461..41518 - 58 NuclAT_0 - Antitoxin
- (41461) 41461..41518 - 58 NuclAT_0 - Antitoxin
- (41461) 41461..41518 - 58 NuclAT_0 - Antitoxin
- (41461) 41461..41518 - 58 NuclAT_0 - Antitoxin
PQQ14_RS23720 (41573) 41573..41725 + 153 WP_001331364.1 Hok/Gef family protein Toxin
PQQ14_RS23725 (41797) 41797..42048 - 252 WP_001291964.1 hypothetical protein -
PQQ14_RS23730 (42549) 42549..42644 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PQQ14_RS23735 (42709) 42709..42885 - 177 WP_001054904.1 hypothetical protein -
PQQ14_RS23740 (43277) 43277..43486 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
PQQ14_RS23745 (43558) 43558..44220 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
PQQ14_RS23750 (44291) 44291..46459 - 2169 WP_023518847.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..87713 87713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T270486 WP_001331364.1 NZ_CP117318:41573-41725 [Salmonella enterica subsp. enterica serovar Derby]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT270486 NZ_CP117318:c41518-41461 [Salmonella enterica subsp. enterica serovar Derby]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References