Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41461..41725 | Replicon | plasmid pRM002_1 |
| Accession | NZ_CP117318 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM002 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | PQQ14_RS23720 | Protein ID | WP_001331364.1 |
| Coordinates | 41573..41725 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 41461..41518 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ14_RS23705 (36700) | 36700..38991 | - | 2292 | WP_274881823.1 | F-type conjugative transfer protein TrbC | - |
| PQQ14_RS23710 (38984) | 38984..40054 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| PQQ14_RS23715 (40073) | 40073..41281 | - | 1209 | WP_039005623.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (41461) | 41461..41518 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (41461) | 41461..41518 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (41461) | 41461..41518 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (41461) | 41461..41518 | - | 58 | NuclAT_0 | - | Antitoxin |
| PQQ14_RS23720 (41573) | 41573..41725 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| PQQ14_RS23725 (41797) | 41797..42048 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| PQQ14_RS23730 (42549) | 42549..42644 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| PQQ14_RS23735 (42709) | 42709..42885 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| PQQ14_RS23740 (43277) | 43277..43486 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PQQ14_RS23745 (43558) | 43558..44220 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PQQ14_RS23750 (44291) | 44291..46459 | - | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..87713 | 87713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T270486 WP_001331364.1 NZ_CP117318:41573-41725 [Salmonella enterica subsp. enterica serovar Derby]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT270486 NZ_CP117318:c41518-41461 [Salmonella enterica subsp. enterica serovar Derby]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
