Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4633675..4634429 Replicon chromosome
Accession NZ_CP117317
Organism Salmonella enterica subsp. enterica serovar Derby strain RM002

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PQQ14_RS22510 Protein ID WP_274881348.1
Coordinates 4633675..4633986 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PQQ14_RS22515 Protein ID WP_001259011.1
Coordinates 4633983..4634429 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ14_RS22480 (4629333) 4629333..4630235 + 903 WP_000331361.1 formate dehydrogenase subunit beta -
PQQ14_RS22485 (4630232) 4630232..4630867 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PQQ14_RS22490 (4630864) 4630864..4631793 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
PQQ14_RS22495 (4631840) 4631840..4632130 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
PQQ14_RS22500 (4632131) 4632131..4632442 - 312 WP_023232499.1 hypothetical protein -
PQQ14_RS22505 (4632660) 4632660..4633589 + 930 WP_023232500.1 alpha/beta hydrolase -
PQQ14_RS22510 (4633675) 4633675..4633986 + 312 WP_274881348.1 type II toxin-antitoxin system HigB family toxin Toxin
PQQ14_RS22515 (4633983) 4633983..4634429 + 447 WP_001259011.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
PQQ14_RS22520 (4634444) 4634444..4635385 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PQQ14_RS22525 (4635430) 4635430..4635867 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
PQQ14_RS22530 (4635864) 4635864..4636733 - 870 WP_023203606.1 virulence factor BrkB family protein -
PQQ14_RS22535 (4636727) 4636727..4637326 - 600 WP_000965695.1 glucose-1-phosphatase -
PQQ14_RS22540 (4637517) 4637517..4638320 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
PQQ14_RS22545 (4638354) 4638354..4639250 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12432.40 Da        Isoelectric Point: 9.5334

>T270484 WP_274881348.1 NZ_CP117317:4633675-4633986 [Salmonella enterica subsp. enterica serovar Derby]
VHVISRKPFNEAMLMYPNHELALTELLNVLERKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16734.08 Da        Isoelectric Point: 6.6451

>AT270484 WP_001259011.1 NZ_CP117317:4633983-4634429 [Salmonella enterica subsp. enterica serovar Derby]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References