Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4631840..4632442 | Replicon | chromosome |
| Accession | NZ_CP117317 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM002 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Y7R225 |
| Locus tag | PQQ14_RS22500 | Protein ID | WP_023232499.1 |
| Coordinates | 4632131..4632442 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ14_RS22495 | Protein ID | WP_000362050.1 |
| Coordinates | 4631840..4632130 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ14_RS22480 (4629333) | 4629333..4630235 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ14_RS22485 (4630232) | 4630232..4630867 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ14_RS22490 (4630864) | 4630864..4631793 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ14_RS22495 (4631840) | 4631840..4632130 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PQQ14_RS22500 (4632131) | 4632131..4632442 | - | 312 | WP_023232499.1 | hypothetical protein | Toxin |
| PQQ14_RS22505 (4632660) | 4632660..4633589 | + | 930 | WP_023232500.1 | alpha/beta hydrolase | - |
| PQQ14_RS22510 (4633675) | 4633675..4633986 | + | 312 | WP_274881348.1 | type II toxin-antitoxin system HigB family toxin | - |
| PQQ14_RS22515 (4633983) | 4633983..4634429 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PQQ14_RS22520 (4634444) | 4634444..4635385 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ14_RS22525 (4635430) | 4635430..4635867 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ14_RS22530 (4635864) | 4635864..4636733 | - | 870 | WP_023203606.1 | virulence factor BrkB family protein | - |
| PQQ14_RS22535 (4636727) | 4636727..4637326 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12388.34 Da Isoelectric Point: 9.4460
>T270483 WP_023232499.1 NZ_CP117317:c4632442-4632131 [Salmonella enterica subsp. enterica serovar Derby]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGVRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGVRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270483 WP_000362050.1 NZ_CP117317:c4632130-4631840 [Salmonella enterica subsp. enterica serovar Derby]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|