Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4635414..4636168 | Replicon | chromosome |
Accession | NZ_CP117312 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM003 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PQP99_RS22515 | Protein ID | WP_274879048.1 |
Coordinates | 4635414..4635725 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQP99_RS22520 | Protein ID | WP_001259011.1 |
Coordinates | 4635722..4636168 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP99_RS22485 (4631072) | 4631072..4631974 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
PQP99_RS22490 (4631971) | 4631971..4632606 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQP99_RS22495 (4632603) | 4632603..4633532 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
PQP99_RS22500 (4633579) | 4633579..4633869 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
PQP99_RS22505 (4633870) | 4633870..4634181 | - | 312 | WP_023232499.1 | hypothetical protein | - |
PQP99_RS22510 (4634399) | 4634399..4635328 | + | 930 | WP_023232500.1 | alpha/beta hydrolase | - |
PQP99_RS22515 (4635414) | 4635414..4635725 | + | 312 | WP_274879048.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PQP99_RS22520 (4635722) | 4635722..4636168 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
PQP99_RS22525 (4636183) | 4636183..4637124 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PQP99_RS22530 (4637169) | 4637169..4637606 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
PQP99_RS22535 (4637603) | 4637603..4638472 | - | 870 | WP_023203606.1 | virulence factor BrkB family protein | - |
PQP99_RS22540 (4638466) | 4638466..4639065 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
PQP99_RS22545 (4639256) | 4639256..4640059 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PQP99_RS22550 (4640093) | 4640093..4640989 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12400.40 Da Isoelectric Point: 9.5206
>T270468 WP_274879048.1 NZ_CP117312:4635414-4635725 [Salmonella enterica subsp. enterica serovar Derby]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKPFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKPFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270468 WP_001259011.1 NZ_CP117312:4635722-4636168 [Salmonella enterica subsp. enterica serovar Derby]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|