Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4640049..4640803 | Replicon | chromosome |
| Accession | NZ_CP117307 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM004 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V4SQJ3 |
| Locus tag | PQQ01_RS22555 | Protein ID | WP_000558164.1 |
| Coordinates | 4640049..4640360 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ01_RS22560 | Protein ID | WP_001259011.1 |
| Coordinates | 4640357..4640803 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ01_RS22525 (4635707) | 4635707..4636609 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ01_RS22530 (4636606) | 4636606..4637241 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ01_RS22535 (4637238) | 4637238..4638167 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ01_RS22540 (4638214) | 4638214..4638504 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ01_RS22545 (4638505) | 4638505..4638816 | - | 312 | WP_023232499.1 | hypothetical protein | - |
| PQQ01_RS22550 (4639034) | 4639034..4639963 | + | 930 | WP_023232500.1 | alpha/beta hydrolase | - |
| PQQ01_RS22555 (4640049) | 4640049..4640360 | + | 312 | WP_000558164.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ01_RS22560 (4640357) | 4640357..4640803 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ01_RS22565 (4640818) | 4640818..4641759 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ01_RS22570 (4641804) | 4641804..4642241 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ01_RS22575 (4642238) | 4642238..4643107 | - | 870 | WP_023203606.1 | virulence factor BrkB family protein | - |
| PQQ01_RS22580 (4643101) | 4643101..4643700 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQQ01_RS22585 (4643891) | 4643891..4644694 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ01_RS22590 (4644728) | 4644728..4645624 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12404.39 Da Isoelectric Point: 9.5206
>T270452 WP_000558164.1 NZ_CP117307:4640049-4640360 [Salmonella enterica subsp. enterica serovar Derby]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270452 WP_001259011.1 NZ_CP117307:4640357-4640803 [Salmonella enterica subsp. enterica serovar Derby]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|