Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4652769..4653523 | Replicon | chromosome |
| Accession | NZ_CP117305 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM005 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V4SQJ3 |
| Locus tag | PQP92_RS22625 | Protein ID | WP_000558164.1 |
| Coordinates | 4652769..4653080 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP92_RS22630 | Protein ID | WP_001259011.1 |
| Coordinates | 4653077..4653523 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP92_RS22595 (4648427) | 4648427..4649329 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQP92_RS22600 (4649326) | 4649326..4649961 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP92_RS22605 (4649958) | 4649958..4650887 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP92_RS22610 (4650934) | 4650934..4651224 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP92_RS22615 (4651225) | 4651225..4651536 | - | 312 | WP_023232499.1 | hypothetical protein | - |
| PQP92_RS22620 (4651754) | 4651754..4652683 | + | 930 | WP_023232500.1 | alpha/beta hydrolase | - |
| PQP92_RS22625 (4652769) | 4652769..4653080 | + | 312 | WP_000558164.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP92_RS22630 (4653077) | 4653077..4653523 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP92_RS22635 (4653538) | 4653538..4654479 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP92_RS22640 (4654524) | 4654524..4654961 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP92_RS22645 (4654958) | 4654958..4655827 | - | 870 | WP_023203606.1 | virulence factor BrkB family protein | - |
| PQP92_RS22650 (4655821) | 4655821..4656420 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQP92_RS22655 (4656611) | 4656611..4657414 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP92_RS22660 (4657448) | 4657448..4658344 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12404.39 Da Isoelectric Point: 9.5206
>T270436 WP_000558164.1 NZ_CP117305:4652769-4653080 [Salmonella enterica subsp. enterica serovar Derby]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLKLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270436 WP_001259011.1 NZ_CP117305:4653077-4653523 [Salmonella enterica subsp. enterica serovar Derby]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|