Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 351223..351761 | Replicon | chromosome |
Accession | NZ_CP117305 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM005 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A3V8R2L4 |
Locus tag | PQP92_RS01570 | Protein ID | WP_023231798.1 |
Coordinates | 351486..351761 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A7U1KUN1 |
Locus tag | PQP92_RS01565 | Protein ID | WP_000729714.1 |
Coordinates | 351223..351483 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP92_RS01550 (346976) | 346976..348529 | + | 1554 | WP_023231801.1 | TROVE domain-containing protein | - |
PQP92_RS01555 (348877) | 348877..350091 | + | 1215 | WP_052895236.1 | RNA-splicing ligase RtcB | - |
PQP92_RS01560 (350095) | 350095..351114 | + | 1020 | WP_023231799.1 | RNA 3'-terminal phosphate cyclase | - |
PQP92_RS01565 (351223) | 351223..351483 | + | 261 | WP_000729714.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP92_RS01570 (351486) | 351486..351761 | + | 276 | WP_023231798.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQP92_RS01575 (351849) | 351849..354554 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10645.22 Da Isoelectric Point: 8.8623
>T270421 WP_023231798.1 NZ_CP117305:351486-351761 [Salmonella enterica subsp. enterica serovar Derby]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDYPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDYPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8R2L4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KUN1 |