Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4630633..4631235 | Replicon | chromosome |
Accession | NZ_CP117301 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM006 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3Y7R225 |
Locus tag | PQP83_RS22475 | Protein ID | WP_023232499.1 |
Coordinates | 4630924..4631235 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQP83_RS22470 | Protein ID | WP_000362050.1 |
Coordinates | 4630633..4630923 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP83_RS22455 (4628126) | 4628126..4629028 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
PQP83_RS22460 (4629025) | 4629025..4629660 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQP83_RS22465 (4629657) | 4629657..4630586 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
PQP83_RS22470 (4630633) | 4630633..4630923 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
PQP83_RS22475 (4630924) | 4630924..4631235 | - | 312 | WP_023232499.1 | hypothetical protein | Toxin |
PQP83_RS22480 (4631453) | 4631453..4632382 | + | 930 | WP_023232500.1 | alpha/beta hydrolase | - |
PQP83_RS22485 (4632468) | 4632468..4632778 | + | 311 | Protein_4393 | type II toxin-antitoxin system HigB family toxin | - |
PQP83_RS22490 (4632775) | 4632775..4633221 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
PQP83_RS22495 (4633236) | 4633236..4634177 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PQP83_RS22500 (4634222) | 4634222..4634659 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
PQP83_RS22505 (4634656) | 4634656..4635525 | - | 870 | WP_023203606.1 | virulence factor BrkB family protein | - |
PQP83_RS22510 (4635519) | 4635519..4636118 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12388.34 Da Isoelectric Point: 9.4460
>T270420 WP_023232499.1 NZ_CP117301:c4631235-4630924 [Salmonella enterica subsp. enterica serovar Derby]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGVRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGVRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270420 WP_000362050.1 NZ_CP117301:c4630923-4630633 [Salmonella enterica subsp. enterica serovar Derby]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|