Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 351228..351766 | Replicon | chromosome |
Accession | NZ_CP117301 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM006 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | A0A3V8R2L4 |
Locus tag | PQP83_RS01570 | Protein ID | WP_023231798.1 |
Coordinates | 351491..351766 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A7U1KUN1 |
Locus tag | PQP83_RS01565 | Protein ID | WP_000729714.1 |
Coordinates | 351228..351488 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP83_RS01550 (346981) | 346981..348534 | + | 1554 | WP_023231801.1 | TROVE domain-containing protein | - |
PQP83_RS01555 (348882) | 348882..350096 | + | 1215 | WP_052895236.1 | RNA-splicing ligase RtcB | - |
PQP83_RS01560 (350100) | 350100..351119 | + | 1020 | WP_023231799.1 | RNA 3'-terminal phosphate cyclase | - |
PQP83_RS01565 (351228) | 351228..351488 | + | 261 | WP_000729714.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP83_RS01570 (351491) | 351491..351766 | + | 276 | WP_023231798.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQP83_RS01575 (351854) | 351854..354559 | - | 2706 | WP_274896453.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10645.22 Da Isoelectric Point: 8.8623
>T270406 WP_023231798.1 NZ_CP117301:351491-351766 [Salmonella enterica subsp. enterica serovar Derby]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDYPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDYPLQGSYSGYRDAHIGPDWILIDKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8R2L4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KUN1 |