Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5854540..5855135 | Replicon | chromosome |
Accession | NZ_CP117300 | ||
Organism | Pseudomonas aeruginosa strain 0201761-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PSH15_RS27895 | Protein ID | WP_071536079.1 |
Coordinates | 5854857..5855135 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PSH15_RS27890 | Protein ID | WP_003099268.1 |
Coordinates | 5854540..5854845 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSH15_RS27855 (PSH15_27855) | 5849680..5850528 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PSH15_RS27865 (PSH15_27865) | 5850695..5851636 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PSH15_RS27870 (PSH15_27870) | 5851753..5852367 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PSH15_RS27875 (PSH15_27875) | 5852409..5852993 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PSH15_RS27880 (PSH15_27880) | 5853034..5854134 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PSH15_RS27890 (PSH15_27890) | 5854540..5854845 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PSH15_RS27895 (PSH15_27895) | 5854857..5855135 | - | 279 | WP_071536079.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PSH15_RS27900 (PSH15_27900) | 5855188..5855316 | - | 129 | Protein_5514 | integrase | - |
PSH15_RS27905 (PSH15_27905) | 5855464..5857692 | + | 2229 | WP_003121052.1 | TonB-dependent receptor | - |
PSH15_RS27910 (PSH15_27910) | 5857762..5858409 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PSH15_RS27915 (PSH15_27915) | 5858471..5859709 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10632.17 Da Isoelectric Point: 7.8937
>T270405 WP_071536079.1 NZ_CP117300:c5855135-5854857 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAGTELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAGTELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|