Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3004737..3005464 | Replicon | chromosome |
| Accession | NZ_CP117299 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A418Z4H3 |
| Locus tag | PH350_RS14680 | Protein ID | WP_017441960.1 |
| Coordinates | 3004737..3005048 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PH350_RS14685 | Protein ID | WP_000561389.1 |
| Coordinates | 3005045..3005464 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH350_RS14650 (2999909) | 2999909..3000631 | - | 723 | WP_017441965.1 | SPI-1 type III secretion system guanine nucleotide exchange factor SopE2 | - |
| PH350_RS14655 (3001312) | 3001312..3001707 | + | 396 | WP_000422887.1 | DUF1398 domain-containing protein | - |
| PH350_RS14660 (3002035) | 3002035..3002511 | + | 477 | WP_017441964.1 | hypothetical protein | - |
| PH350_RS14665 (3002663) | 3002663..3002815 | + | 153 | WP_153257556.1 | hypothetical protein | - |
| PH350_RS14670 (3003178) | 3003178..3003960 | + | 783 | WP_023242818.1 | DUF2971 domain-containing protein | - |
| PH350_RS14675 (3004259) | 3004259..3004558 | - | 300 | WP_017441961.1 | hypothetical protein | - |
| PH350_RS14680 (3004737) | 3004737..3005048 | + | 312 | WP_017441960.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PH350_RS14685 (3005045) | 3005045..3005464 | + | 420 | WP_000561389.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PH350_RS14690 (3005720) | 3005720..3006214 | + | 495 | WP_077907251.1 | glycosyltransferase | - |
| PH350_RS14695 (3006211) | 3006211..3006369 | + | 159 | WP_023165344.1 | lipopolysaccharide 1,2-N-acetylglucosaminetransferase | - |
| PH350_RS14700 (3006605) | 3006605..3007024 | - | 420 | WP_017441959.1 | GNAT family N-acetyltransferase | - |
| PH350_RS14705 (3007395) | 3007395..3007664 | + | 270 | WP_077907250.1 | hypothetical protein | - |
| PH350_RS14710 (3007830) | 3007830..3007970 | + | 141 | WP_031615664.1 | hypothetical protein | - |
| PH350_RS14715 (3008116) | 3008116..3008644 | - | 529 | Protein_2869 | transposase | - |
| PH350_RS14720 (3008664) | 3008664..3008756 | - | 93 | WP_230855586.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3008116..3008454 | 338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12453.27 Da Isoelectric Point: 10.1599
>T270389 WP_017441960.1 NZ_CP117299:3004737-3005048 [Salmonella enterica subsp. enterica serovar Mbandaka]
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
MHVISKEPFDEAARRYPNDSLAIKALYRLVRERDFSSPAELRKVIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFINKRF
YVKHIATHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15301.49 Da Isoelectric Point: 4.6286
>AT270389 WP_000561389.1 NZ_CP117299:3005045-3005464 [Salmonella enterica subsp. enterica serovar Mbandaka]
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MIANTAKAIEATKALVAAVPFLGGSASEKDYRDALALVDYLIENDDENPLIDFLASKIAEYEDNSKQFAEFNKSVAEMPV
GVALLRTLIDQYKLSYSDLKEEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|