Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 351800..352402 | Replicon | chromosome |
| Accession | NZ_CP117299 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3V4SQH3 |
| Locus tag | PH350_RS01715 | Protein ID | WP_001159628.1 |
| Coordinates | 351800..352111 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PH350_RS01720 | Protein ID | WP_000362050.1 |
| Coordinates | 352112..352402 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH350_RS01680 (346913) | 346913..347512 | + | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| PH350_RS01685 (347506) | 347506..348378 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PH350_RS01690 (348375) | 348375..348812 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PH350_RS01695 (348857) | 348857..349798 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PH350_RS01700 (349813) | 349813..350259 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PH350_RS01705 (350256) | 350256..350567 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| PH350_RS01710 (350653) | 350653..351582 | - | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| PH350_RS01715 (351800) | 351800..352111 | + | 312 | WP_001159628.1 | hypothetical protein | Toxin |
| PH350_RS01720 (352112) | 352112..352402 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| PH350_RS01725 (352449) | 352449..353378 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PH350_RS01730 (353375) | 353375..354010 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PH350_RS01735 (354007) | 354007..354909 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12376.29 Da Isoelectric Point: 9.4460
>T270376 WP_001159628.1 NZ_CP117299:351800-352111 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKFQVFMAQHPDCGDVIQETGGLRKMRWGSRGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT270376 WP_000362050.1 NZ_CP117299:352112-352402 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|