Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3501644..3502314 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | O53332 |
| Locus tag | PQK93_RS16525 | Protein ID | WP_003899954.1 |
| Coordinates | 3501644..3501988 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0THF6 |
| Locus tag | PQK93_RS16530 | Protein ID | WP_003899955.1 |
| Coordinates | 3501985..3502314 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS16490 (PQK93_16490) | 3496717..3497577 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
| PQK93_RS16495 (PQK93_16495) | 3497552..3498067 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
| PQK93_RS16500 (PQK93_16500) | 3498083..3498294 | + | 212 | Protein_3257 | (R)-hydratase | - |
| PQK93_RS16505 (PQK93_16505) | 3498307..3498600 | + | 294 | WP_003416635.1 | hypothetical protein | - |
| PQK93_RS16510 (PQK93_16510) | 3498888..3500177 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
| PQK93_RS16515 (PQK93_16515) | 3500524..3500958 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS16520 (PQK93_16520) | 3500961..3501413 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PQK93_RS16525 (PQK93_16525) | 3501644..3501988 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQK93_RS16530 (PQK93_16530) | 3501985..3502314 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
| PQK93_RS16535 (PQK93_16535) | 3502852..3503199 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
| PQK93_RS16540 (PQK93_16540) | 3503196..3503816 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
| PQK93_RS16545 (PQK93_16545) | 3503976..3505241 | - | 1266 | WP_003909837.1 | hypothetical protein | - |
| PQK93_RS16550 (PQK93_16550) | 3505409..3505618 | + | 210 | WP_003416778.1 | hypothetical protein | - |
| PQK93_RS16555 (PQK93_16555) | 3505865..3506899 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T270370 WP_003899954.1 NZ_CP117298:3501644-3501988 [Mycobacterium tuberculosis variant bovis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Download Length: 110 a.a. Molecular weight: 11802.46 Da Isoelectric Point: 7.4051
>AT270370 WP_003899955.1 NZ_CP117298:3501985-3502314 [Mycobacterium tuberculosis variant bovis]
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
MTMARNWRDIRADAVAQGRVDLQRAAVAREEMRDAVLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTEL
GTLQAYVAALGGHLRIVAEFGENTVELTA
Download Length: 330 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBK2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6LTY | |
| PDB | 6LTZ | |
| AlphaFold DB | G0THF6 |