Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
| Location | 2186576..2187444 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | P9WJA4 |
| Locus tag | PQK93_RS10180 | Protein ID | WP_010886136.1 |
| Coordinates | 2186576..2186953 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | G0TLM0 |
| Locus tag | PQK93_RS10185 | Protein ID | WP_003409886.1 |
| Coordinates | 2186995..2187444 (+) | Length | 150 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS10125 (PQK93_10125) | 2182089..2182541 | - | 453 | WP_010950636.1 | lipoprotein | - |
| PQK93_RS10130 (PQK93_10130) | 2182605..2183006 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| PQK93_RS10135 (PQK93_10135) | 2182999..2183181 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| PQK93_RS10140 (PQK93_10140) | 2183275..2183457 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| PQK93_RS10145 (PQK93_10145) | 2183571..2183921 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| PQK93_RS10150 (PQK93_10150) | 2183932..2184834 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| PQK93_RS10155 (PQK93_10155) | 2184855..2185046 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| PQK93_RS10160 (PQK93_10160) | 2185047..2185343 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| PQK93_RS10165 (PQK93_10165) | 2185583..2185798 | + | 216 | WP_003409878.1 | antitoxin | - |
| PQK93_RS10170 (PQK93_10170) | 2185795..2186106 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS10175 (PQK93_10175) | 2186080..2186601 | - | 522 | WP_010950637.1 | hypothetical protein | - |
| PQK93_RS10180 (PQK93_10180) | 2186576..2186953 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PQK93_RS10185 (PQK93_10185) | 2186995..2187444 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PQK93_RS10190 (PQK93_10190) | 2187441..2187986 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| PQK93_RS10195 (PQK93_10195) | 2187875..2188489 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| PQK93_RS10200 (PQK93_10200) | 2188538..2188834 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PQK93_RS10205 (PQK93_10205) | 2188831..2189082 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PQK93_RS10210 (PQK93_10210) | 2189069..2189563 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| PQK93_RS10215 (PQK93_10215) | 2189723..2190130 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS10220 (PQK93_10220) | 2190134..2190406 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PQK93_RS10225 (PQK93_10225) | 2190439..2191659 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T270347 WP_010886136.1 NZ_CP117298:2186576-2186953 [Mycobacterium tuberculosis variant bovis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT270347 WP_003409886.1 NZ_CP117298:2186995-2187444 [Mycobacterium tuberculosis variant bovis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|