Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4680787..4681541 | Replicon | chromosome |
| Accession | NZ_CP117294 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | PRW94_RS23060 | Protein ID | WP_000558160.1 |
| Coordinates | 4680787..4681098 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PRW94_RS23065 | Protein ID | WP_001259009.1 |
| Coordinates | 4681095..4681541 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRW94_RS23030 (PRW94_23030) | 4676453..4677355 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PRW94_RS23035 (PRW94_23035) | 4677352..4677987 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PRW94_RS23040 (PRW94_23040) | 4677984..4678913 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| PRW94_RS23045 (PRW94_23045) | 4678951..4679325 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| PRW94_RS23050 (PRW94_23050) | 4679325..4679567 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PRW94_RS23055 (PRW94_23055) | 4679772..4680701 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PRW94_RS23060 (PRW94_23060) | 4680787..4681098 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PRW94_RS23065 (PRW94_23065) | 4681095..4681541 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PRW94_RS23070 (PRW94_23070) | 4681556..4682497 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PRW94_RS23075 (PRW94_23075) | 4682542..4682979 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PRW94_RS23080 (PRW94_23080) | 4682976..4683848 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PRW94_RS23085 (PRW94_23085) | 4683842..4684441 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PRW94_RS23090 (PRW94_23090) | 4684632..4685435 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| PRW94_RS23095 (PRW94_23095) | 4685469..4686365 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T270314 WP_000558160.1 NZ_CP117294:4680787-4681098 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT270314 WP_001259009.1 NZ_CP117294:4681095-4681541 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|