Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4679242..4679996 | Replicon | chromosome |
Accession | NZ_CP117293 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain S2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q8Z2U0 |
Locus tag | PRW95_RS23050 | Protein ID | WP_000558160.1 |
Coordinates | 4679242..4679553 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PRW95_RS23055 | Protein ID | WP_001259009.1 |
Coordinates | 4679550..4679996 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRW95_RS23020 (PRW95_23020) | 4674908..4675810 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
PRW95_RS23025 (PRW95_23025) | 4675807..4676442 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PRW95_RS23030 (PRW95_23030) | 4676439..4677368 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
PRW95_RS23035 (PRW95_23035) | 4677406..4677780 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
PRW95_RS23040 (PRW95_23040) | 4677780..4678022 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
PRW95_RS23045 (PRW95_23045) | 4678227..4679156 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
PRW95_RS23050 (PRW95_23050) | 4679242..4679553 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PRW95_RS23055 (PRW95_23055) | 4679550..4679996 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
PRW95_RS23060 (PRW95_23060) | 4680011..4680952 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PRW95_RS23065 (PRW95_23065) | 4680997..4681434 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
PRW95_RS23070 (PRW95_23070) | 4681431..4682303 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
PRW95_RS23075 (PRW95_23075) | 4682297..4682896 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
PRW95_RS23080 (PRW95_23080) | 4683087..4683890 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
PRW95_RS23085 (PRW95_23085) | 4683924..4684820 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T270299 WP_000558160.1 NZ_CP117293:4679242-4679553 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT270299 WP_001259009.1 NZ_CP117293:4679550-4679996 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|