Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 536637..537391 | Replicon | chromosome |
| Accession | NZ_CP117292 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain S4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8Z2U0 |
| Locus tag | PRW96_RS02570 | Protein ID | WP_000558160.1 |
| Coordinates | 537080..537391 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PRW96_RS02565 | Protein ID | WP_001259009.1 |
| Coordinates | 536637..537083 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRW96_RS02535 (PRW96_02535) | 531813..532709 | + | 897 | WP_001520529.1 | sugar kinase | - |
| PRW96_RS02540 (PRW96_02540) | 532743..533546 | + | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
| PRW96_RS02545 (PRW96_02545) | 533737..534336 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PRW96_RS02550 (PRW96_02550) | 534330..535202 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PRW96_RS02555 (PRW96_02555) | 535199..535636 | + | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PRW96_RS02560 (PRW96_02560) | 535681..536622 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PRW96_RS02565 (PRW96_02565) | 536637..537083 | - | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PRW96_RS02570 (PRW96_02570) | 537080..537391 | - | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PRW96_RS02575 (PRW96_02575) | 537477..538406 | - | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PRW96_RS02580 (PRW96_02580) | 538611..538853 | + | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
| PRW96_RS02585 (PRW96_02585) | 538853..539227 | + | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
| PRW96_RS02590 (PRW96_02590) | 539265..540194 | - | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| PRW96_RS02595 (PRW96_02595) | 540191..540826 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PRW96_RS02600 (PRW96_02600) | 540823..541725 | - | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T270271 WP_000558160.1 NZ_CP117292:c537391-537080 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT270271 WP_001259009.1 NZ_CP117292:c537083-536637 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|