Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4635580..4636334 | Replicon | chromosome |
Accession | NZ_CP117290 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain S6 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q8Z2U0 |
Locus tag | PRW98_RS22835 | Protein ID | WP_000558160.1 |
Coordinates | 4635580..4635891 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PRW98_RS22840 | Protein ID | WP_001259009.1 |
Coordinates | 4635888..4636334 (+) | Length | 149 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PRW98_RS22805 (PRW98_22805) | 4631246..4632148 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
PRW98_RS22810 (PRW98_22810) | 4632145..4632780 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
PRW98_RS22815 (PRW98_22815) | 4632777..4633706 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
PRW98_RS22820 (PRW98_22820) | 4633744..4634118 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | - |
PRW98_RS22825 (PRW98_22825) | 4634118..4634360 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | - |
PRW98_RS22830 (PRW98_22830) | 4634565..4635494 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
PRW98_RS22835 (PRW98_22835) | 4635580..4635891 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
PRW98_RS22840 (PRW98_22840) | 4635888..4636334 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
PRW98_RS22845 (PRW98_22845) | 4636349..4637290 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
PRW98_RS22850 (PRW98_22850) | 4637335..4637772 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
PRW98_RS22855 (PRW98_22855) | 4637769..4638641 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
PRW98_RS22860 (PRW98_22860) | 4638635..4639234 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
PRW98_RS22865 (PRW98_22865) | 4639425..4640228 | - | 804 | WP_000059689.1 | DeoR family transcriptional regulator | - |
PRW98_RS22870 (PRW98_22870) | 4640262..4641158 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12449.38 Da Isoelectric Point: 8.4020
>T270254 WP_000558160.1 NZ_CP117290:4635580-4635891 [Salmonella enterica subsp. enterica serovar Typhi]
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
VHVISRKLFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNEE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT270254 WP_001259009.1 NZ_CP117290:4635888-4636334 [Salmonella enterica subsp. enterica serovar Typhi]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|