Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 294701..295214 Replicon chromosome
Accession NZ_CP117289
Organism Streptococcus dysgalactiae subsp. equisimilis strain MGCS35823

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag MGCS35823_RS01630 Protein ID WP_084916229.1
Coordinates 294701..294955 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag MGCS35823_RS01635 Protein ID WP_003053797.1
Coordinates 294948..295214 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MGCS35823_RS01600 (MGCS35823_00648) 290943..291353 - 411 WP_003053802.1 conjugal transfer protein -
MGCS35823_RS01605 (MGCS35823_00650) 291356..291580 - 225 WP_003053785.1 hypothetical protein -
MGCS35823_RS01610 (MGCS35823_00652) 291584..292594 - 1011 WP_022554213.1 conjugal transfer protein -
MGCS35823_RS01615 (MGCS35823_00654) 292606..293142 - 537 WP_003053800.1 hypothetical protein -
MGCS35823_RS01620 (MGCS35823_00656) 293169..293399 - 231 WP_003053793.1 hypothetical protein -
MGCS35823_RS01625 (MGCS35823_00658) 293419..294645 - 1227 WP_084916231.1 replication initiation factor domain-containing protein -
MGCS35823_RS01630 (MGCS35823_00660) 294701..294955 - 255 WP_084916229.1 Txe/YoeB family addiction module toxin Toxin
MGCS35823_RS01635 (MGCS35823_00662) 294948..295214 - 267 WP_003053797.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MGCS35823_RS01640 (MGCS35823_00664) 295479..297164 - 1686 WP_275910582.1 FtsK/SpoIIIE domain-containing protein -
MGCS35823_RS01645 (MGCS35823_00666) 297181..297642 - 462 WP_003056467.1 hypothetical protein -
MGCS35823_RS01650 (MGCS35823_00668) 297661..297957 - 297 WP_003056470.1 hypothetical protein -
MGCS35823_RS01655 (MGCS35823_00670) 297997..298242 - 246 WP_003056472.1 hypothetical protein -
MGCS35823_RS01660 (MGCS35823_00672) 298815..299156 + 342 WP_110408064.1 helix-turn-helix transcriptional regulator -
MGCS35823_RS01665 (MGCS35823_00674) 299360..299665 + 306 WP_014612001.1 hypothetical protein -
MGCS35823_RS01670 (MGCS35823_00676) 299700..300059 - 360 WP_003053656.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 270964..317286 46322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(4-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10502.78 Da        Isoelectric Point: 8.4060

>T270237 WP_084916229.1 NZ_CP117289:c294955-294701 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK

Download         Length: 255 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10402.81 Da        Isoelectric Point: 4.5216

>AT270237 WP_003053797.1 NZ_CP117289:c295214-294948 [Streptococcus dysgalactiae subsp. equisimilis]
MEAVVYSNFRNNLKDYMKKVNDEYEPLMVVNKNPEENIVVLSKDNWDSIQETIRIMNNEYLSDKVLSGLEQVKQKKVTQH
QLLEVEDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References