Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 288787..289300 | Replicon | chromosome |
| Accession | NZ_CP117288 | ||
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain MGCS35957 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | MGCS35957_RS01550 | Protein ID | WP_084916229.1 |
| Coordinates | 288787..289041 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | MGCS35957_RS01555 | Protein ID | WP_003053797.1 |
| Coordinates | 289034..289300 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGCS35957_RS01520 (MGCS35957_00622) | 285029..285439 | - | 411 | WP_003053802.1 | conjugal transfer protein | - |
| MGCS35957_RS01525 (MGCS35957_00624) | 285442..285666 | - | 225 | WP_003053785.1 | hypothetical protein | - |
| MGCS35957_RS01530 (MGCS35957_00626) | 285670..286680 | - | 1011 | WP_022554213.1 | conjugal transfer protein | - |
| MGCS35957_RS01535 (MGCS35957_00628) | 286692..287228 | - | 537 | WP_003053800.1 | hypothetical protein | - |
| MGCS35957_RS01540 (MGCS35957_00630) | 287255..287485 | - | 231 | WP_003053793.1 | hypothetical protein | - |
| MGCS35957_RS01545 (MGCS35957_00632) | 287505..288731 | - | 1227 | WP_084916231.1 | replication initiation factor domain-containing protein | - |
| MGCS35957_RS01550 (MGCS35957_00634) | 288787..289041 | - | 255 | WP_084916229.1 | Txe/YoeB family addiction module toxin | Toxin |
| MGCS35957_RS01555 (MGCS35957_00636) | 289034..289300 | - | 267 | WP_003053797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MGCS35957_RS01560 (MGCS35957_00638) | 289565..291250 | - | 1686 | WP_084916228.1 | FtsK/SpoIIIE domain-containing protein | - |
| MGCS35957_RS01565 (MGCS35957_00640) | 291267..291728 | - | 462 | WP_003056467.1 | hypothetical protein | - |
| MGCS35957_RS01570 (MGCS35957_00642) | 291747..292043 | - | 297 | WP_003056470.1 | hypothetical protein | - |
| MGCS35957_RS01575 (MGCS35957_00644) | 292083..292328 | - | 246 | WP_003056472.1 | hypothetical protein | - |
| MGCS35957_RS01580 (MGCS35957_00646) | 292901..293242 | + | 342 | WP_110408064.1 | helix-turn-helix transcriptional regulator | - |
| MGCS35957_RS01585 (MGCS35957_00648) | 293446..293751 | + | 306 | WP_014612001.1 | hypothetical protein | - |
| MGCS35957_RS01590 (MGCS35957_00650) | 293786..294145 | - | 360 | WP_003053656.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10502.78 Da Isoelectric Point: 8.4060
>T270234 WP_084916229.1 NZ_CP117288:c289041-288787 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|