Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 294697..295210 Replicon chromosome
Accession NZ_CP117284
Organism Streptococcus dysgalactiae subsp. equisimilis strain MGCS36089

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag MGCS36089_RS01620 Protein ID WP_084916229.1
Coordinates 294697..294951 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag MGCS36089_RS01625 Protein ID WP_003053797.1
Coordinates 294944..295210 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MGCS36089_RS01590 (MGCS36089_00642) 290939..291349 - 411 WP_003053802.1 conjugal transfer protein -
MGCS36089_RS01595 (MGCS36089_00644) 291352..291576 - 225 WP_003053785.1 hypothetical protein -
MGCS36089_RS01600 (MGCS36089_00646) 291580..292590 - 1011 WP_022554213.1 conjugal transfer protein -
MGCS36089_RS01605 (MGCS36089_00648) 292602..293138 - 537 WP_003053800.1 hypothetical protein -
MGCS36089_RS01610 (MGCS36089_00650) 293165..293395 - 231 WP_003053793.1 hypothetical protein -
MGCS36089_RS01615 (MGCS36089_00652) 293415..294641 - 1227 WP_084916231.1 replication initiation factor domain-containing protein -
MGCS36089_RS01620 (MGCS36089_00654) 294697..294951 - 255 WP_084916229.1 Txe/YoeB family addiction module toxin Toxin
MGCS36089_RS01625 (MGCS36089_00656) 294944..295210 - 267 WP_003053797.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MGCS36089_RS01630 (MGCS36089_00658) 295475..297160 - 1686 WP_084916228.1 FtsK/SpoIIIE domain-containing protein -
MGCS36089_RS01635 (MGCS36089_00660) 297177..297638 - 462 WP_003056467.1 hypothetical protein -
MGCS36089_RS01640 (MGCS36089_00662) 297657..297953 - 297 WP_003056470.1 hypothetical protein -
MGCS36089_RS01645 (MGCS36089_00664) 297993..298238 - 246 WP_003056472.1 hypothetical protein -
MGCS36089_RS01650 (MGCS36089_00666) 298811..299152 + 342 WP_110408064.1 helix-turn-helix transcriptional regulator -
MGCS36089_RS01655 (MGCS36089_00668) 299356..299661 + 306 WP_014612001.1 hypothetical protein -
MGCS36089_RS01660 (MGCS36089_00670) 299696..300055 - 360 WP_003053656.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 269172..310934 41762
- inside Prophage - - 267560..313191 45631


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(4-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10502.78 Da        Isoelectric Point: 8.4060

>T270225 WP_084916229.1 NZ_CP117284:c294951-294697 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK

Download         Length: 255 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10402.81 Da        Isoelectric Point: 4.5216

>AT270225 WP_003053797.1 NZ_CP117284:c295210-294944 [Streptococcus dysgalactiae subsp. equisimilis]
MEAVVYSNFRNNLKDYMKKVNDEYEPLMVVNKNPEENIVVLSKDNWDSIQETIRIMNNEYLSDKVLSGLEQVKQKKVTQH
QLLEVEDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References