Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
| Location | 294697..295210 | Replicon | chromosome |
| Accession | NZ_CP117284 | ||
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain MGCS36089 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | MGCS36089_RS01620 | Protein ID | WP_084916229.1 |
| Coordinates | 294697..294951 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | MGCS36089_RS01625 | Protein ID | WP_003053797.1 |
| Coordinates | 294944..295210 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGCS36089_RS01590 (MGCS36089_00642) | 290939..291349 | - | 411 | WP_003053802.1 | conjugal transfer protein | - |
| MGCS36089_RS01595 (MGCS36089_00644) | 291352..291576 | - | 225 | WP_003053785.1 | hypothetical protein | - |
| MGCS36089_RS01600 (MGCS36089_00646) | 291580..292590 | - | 1011 | WP_022554213.1 | conjugal transfer protein | - |
| MGCS36089_RS01605 (MGCS36089_00648) | 292602..293138 | - | 537 | WP_003053800.1 | hypothetical protein | - |
| MGCS36089_RS01610 (MGCS36089_00650) | 293165..293395 | - | 231 | WP_003053793.1 | hypothetical protein | - |
| MGCS36089_RS01615 (MGCS36089_00652) | 293415..294641 | - | 1227 | WP_084916231.1 | replication initiation factor domain-containing protein | - |
| MGCS36089_RS01620 (MGCS36089_00654) | 294697..294951 | - | 255 | WP_084916229.1 | Txe/YoeB family addiction module toxin | Toxin |
| MGCS36089_RS01625 (MGCS36089_00656) | 294944..295210 | - | 267 | WP_003053797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MGCS36089_RS01630 (MGCS36089_00658) | 295475..297160 | - | 1686 | WP_084916228.1 | FtsK/SpoIIIE domain-containing protein | - |
| MGCS36089_RS01635 (MGCS36089_00660) | 297177..297638 | - | 462 | WP_003056467.1 | hypothetical protein | - |
| MGCS36089_RS01640 (MGCS36089_00662) | 297657..297953 | - | 297 | WP_003056470.1 | hypothetical protein | - |
| MGCS36089_RS01645 (MGCS36089_00664) | 297993..298238 | - | 246 | WP_003056472.1 | hypothetical protein | - |
| MGCS36089_RS01650 (MGCS36089_00666) | 298811..299152 | + | 342 | WP_110408064.1 | helix-turn-helix transcriptional regulator | - |
| MGCS36089_RS01655 (MGCS36089_00668) | 299356..299661 | + | 306 | WP_014612001.1 | hypothetical protein | - |
| MGCS36089_RS01660 (MGCS36089_00670) | 299696..300055 | - | 360 | WP_003053656.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 269172..310934 | 41762 | |
| - | inside | Prophage | - | - | 267560..313191 | 45631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10502.78 Da Isoelectric Point: 8.4060
>T270225 WP_084916229.1 NZ_CP117284:c294951-294697 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
MFNFTEEAWEDYTSWQREDKKNLKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|