Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 404238..404829 | Replicon | chromosome |
Accession | NZ_CP117261 | ||
Organism | Rhizobium tumorigenes strain 932 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PR016_RS01975 | Protein ID | WP_278331359.1 |
Coordinates | 404238..404522 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | PR016_RS01980 | Protein ID | WP_278331360.1 |
Coordinates | 404533..404829 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PR016_RS01960 (PR016_01960) | 400231..400782 | + | 552 | WP_278331356.1 | LemA family protein | - |
PR016_RS01965 (PR016_01965) | 400878..402152 | + | 1275 | WP_278331357.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
PR016_RS01970 (PR016_01970) | 402201..404135 | + | 1935 | WP_278331358.1 | DUF2207 domain-containing protein | - |
PR016_RS01975 (PR016_01975) | 404238..404522 | + | 285 | WP_278331359.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PR016_RS01980 (PR016_01980) | 404533..404829 | + | 297 | WP_278331360.1 | HigA family addiction module antitoxin | Antitoxin |
PR016_RS01985 (PR016_01985) | 404935..407169 | + | 2235 | WP_278331361.1 | glycine--tRNA ligase subunit beta | - |
PR016_RS01990 (PR016_01990) | 407227..407808 | - | 582 | WP_278331363.1 | histidine phosphatase family protein | - |
PR016_RS01995 (PR016_01995) | 407978..409795 | - | 1818 | WP_278331364.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10433.88 Da Isoelectric Point: 7.2784
>T270205 WP_278331359.1 NZ_CP117261:404238-404522 [Rhizobium tumorigenes]
MAILSFKDGSTRAVASGAVPKGFPADLARRAIRKLTMIEFANQLSDLRSPPANHLEALKGDRAGQHSIRINDQWRICFVW
TDAGVEDVEIVDYH
MAILSFKDGSTRAVASGAVPKGFPADLARRAIRKLTMIEFANQLSDLRSPPANHLEALKGDRAGQHSIRINDQWRICFVW
TDAGVEDVEIVDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|