Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4674985..4675739 | Replicon | chromosome |
| Accession | NZ_CP117244 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQQ30_RS22720 | Protein ID | WP_000558166.1 |
| Coordinates | 4674985..4675296 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ30_RS22725 | Protein ID | WP_001259011.1 |
| Coordinates | 4675293..4675739 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ30_RS22690 (4670643) | 4670643..4671545 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| PQQ30_RS22695 (4671542) | 4671542..4672177 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQQ30_RS22700 (4672174) | 4672174..4673103 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQQ30_RS22705 (4673150) | 4673150..4673440 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQQ30_RS22710 (4673441) | 4673441..4673752 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQQ30_RS22715 (4673970) | 4673970..4674899 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQQ30_RS22720 (4674985) | 4674985..4675296 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQQ30_RS22725 (4675293) | 4675293..4675739 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQQ30_RS22730 (4675754) | 4675754..4676695 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQQ30_RS22735 (4676740) | 4676740..4677177 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQQ30_RS22740 (4677174) | 4677174..4678046 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQQ30_RS22745 (4678040) | 4678040..4678639 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQQ30_RS22750 (4678830) | 4678830..4679633 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQQ30_RS22755 (4679667) | 4679667..4680563 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270185 WP_000558166.1 NZ_CP117244:4674985-4675296 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270185 WP_001259011.1 NZ_CP117244:4675293-4675739 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|